PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02389.1.p
Common NameEUGRSUZ_J02389, LOC104422734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SRS
Protein Properties Length: 325aa    MW: 35133.8 Da    PI: 6.4988
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02389.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7021012.2e-31110164256
            DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqql 56 
                       r+g++sCqdCGnqakkdC+h RCRtCCksrg+ C thvkstWvpa++rrerqq +
  Eucgr.J02389.1.p 110 REGGISCQDCGNQAKKDCVHFRCRTCCKSRGLPCDTHVKSTWVPASRRRERQQLQ 164
                       67999**********************************************9865 PP

2DUF70290.63.4e-2818424394154
            DUF702  94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       a+ ++ le+ ++P+ev+s+a+frcvrvss+dd+++++aYqtav+igGhvfkGiLydqG+++
  Eucgr.J02389.1.p 184 AN-SSGLEMGNFPAEVNSSALFRCVRVSSIDDNDDQYAYQTAVNIGGHVFKGILYDQGPDH 243
                       43.45788999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-56113242IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.9E-26115157IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.6E-29194241IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MAGFFSIGSG GRGTHKQQSH PPAVAEELET QQANNSISVD PGWLWYRNGV VSSSSSSHKG  60
FELCHQLQPQ QQLQLQHQQD LYLSSPPSPR MNASDDESLR SGPSAFLLMR EGGISCQDCG  120
NQAKKDCVHF RCRTCCKSRG LPCDTHVKST WVPASRRRER QQLQLLHGGD CVKRLREDHD  180
LPHANSSGLE MGNFPAEVNS SALFRCVRVS SIDDNDDQYA YQTAVNIGGH VFKGILYDQG  240
PDHANYMAAG ESSSVHLGGD GSGGIQQLSL IAAAAAGDTM TTQEDGNNNA AVSQVAAPLF  300
DPSSMYPTQL NNFMGGAQFF PHPR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02389.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412852e-47AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
GenBankAP0053142e-47AP005314.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0515E01.
GenBankAP0055672e-47AP005567.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1254_E07.
GenBankAP0149652e-47AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126172e-47CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033452.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like isoform X1
TrEMBLA0A059AGY10.0A0A059AGY1_EUCGR; Uncharacterized protein
STRINGVIT_04s0023g02780.t011e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.16e-62Lateral root primordium (LRP) protein-related